PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29676.m001636
Common NameLOC8267244, RCOM_0602150
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family G2-like
Protein Properties Length: 370aa    MW: 41998.9 Da    PI: 6.7886
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29676.m001636genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32231286156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rF++a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  29676.m001636 231 KQRRCWSPELHRRFIDALHQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 286
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-18229289IPR009057Homeodomain-like
PROSITE profilePS5129412.721230288IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.4E-29230289IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-26231286IPR006447Myb domain, plants
PfamPF002491.5E-8233284IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MELSLDLSLV YVPKTISEYL KEVSKVKDSS LKLSKLDDYV QRLEDEMRKI DAFKRELPLC  60
MLLLNDAIVR LKEEAMQCKE LEEVVSVKGN SCRNEERELE NDMIDKKNWM SSVQLWNNNN  120
HTNNNNFDSE NQESKSETKQ RSEEDDDRST CENPTQLCNH RSKGGGFMPF KSTSGFEKKE  180
EKEVVSQVTG LSLMTPVSEL GSRNLMSKTN GTDQFKIQNK PQQQQQQPYK KQRRCWSPEL  240
HRRFIDALHQ LGGSQVATPK QIRELMQVDG LTNDEVKSHL QKYRLHIRKL PASSAAQANA  300
LWMAQNGHKD DSSKQSNSKS SSPQGPLHGC GSAKGMSSTG GDSMEVEDDD RSVSNSWNGR  360
QHKQAGEVDV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002522328.10.0PREDICTED: probable transcription factor KAN3
TrEMBLB9S8K90.0B9S8K9_RICCO; DNA binding protein, putative
STRINGPOPTR_0007s11470.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-65G2-like family protein